PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P26230_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 322aa    MW: 36340.1 Da    PI: 6.1336
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P26230_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox309e-102452831755
                            HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            el +k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  GSMUA_Achr3P26230_001 245 ELHYKWPYPSEAQKAALAESTGLDMKQINNWFINQRKRH 283
                            5566789*****************************885 PP

2ELK377e-13203224122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+Ll+KY+gyL+sLkqE+s
  GSMUA_Achr3P26230_001 203 ELKHHLLKKYGGYLSSLKQELS 224
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-959102IPR005540KNOX1
PfamPF037903.6E-1660101IPR005540KNOX1
SMARTSM012561.6E-25109160IPR005541KNOX2
PfamPF037917.9E-24114158IPR005541KNOX2
SMARTSM01188670118138IPR005539ELK domain
SMARTSM011885.7E-7203224IPR005539ELK domain
PfamPF037891.0E-9203224IPR005539ELK domain
PROSITE profilePS5121311.331203223IPR005539ELK domain
PROSITE profilePS5007112.714223286IPR001356Homeobox domain
SuperFamilySSF466896.42E-20224299IPR009057Homeodomain-like
SMARTSM003891.8E-13225290IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-28228288IPR009057Homeodomain-like
CDDcd000866.94E-13235287No hitNo description
PfamPF059204.5E-17243282IPR008422Homeobox KN domain
PROSITE patternPS000270261284IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MCTPSSSAKQ TTATAASAFD RRYCVPNPFL PSDHHENPNL LQAKPDVAST SQIPQGDVDA  60
IKAKIVSHPH FPSANTSLAC LQVGAPPEVA ARLSAVAQEF EMRQRASLIC RDAVADPELD  120
QFMEAYHDML VKYREELSRP LQEAMEFLGR MESQLNSISD NTGSLRIISN DDKFGVCSVE  180
ENQEGSGGEM DIMELDPCTE DQELKHHLLK KYGGYLSSLK QELSKKKKKG KLPKDARQQL  240
LNWWELHYKW PYPSEAQKAA LAESTGLDMK QINNWFINQR KRHWKPSEDM QFVMMDGYHA  300
PNAAALYMDG HFMSEGLYRF GP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393976.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotP466091e-132KNOS6_ORYSJ; Homeobox protein knotted-1-like 6
TrEMBLM0SHY90.0M0SHY9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P26230_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-106KNOTTED-like from Arabidopsis thaliana